SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016450 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016450
Domain Number 1 Region: 296-605
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 4.58e-41
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 707-876
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 89-211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1013-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016450
Domain Number - Region: 59-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016450   Gene: ENSPANG00000020713   Transcript: ENSPANT00000012226
Sequence length 1279
Comment pep:known_by_projection chromosome:PapAnu2.0:9:106731454:107161187:1 gene:ENSPANG00000020713 transcript:ENSPANT00000012226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGAPQPATPGLWRARPAGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSK
PCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTW
LIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVV
TTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWKG
EACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSP
SVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYDLESSIWNVGTLSRGPLQRYGHSLA
LYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMEL
DSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSI
YVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTH
NDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSS
VLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNIVRAKCPPKTA
ASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTS
CKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRINASRENYDNAKLYCYNLSG
NLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEP
NDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTS
NGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWC
NDPSNTGRGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKSYEWSFIQCPACQCNGHST
CINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTTK
GIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSN
KNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKNNIKEYRDSFSYEKFNFRSNPN
ITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWAS
RRREVSVILFNLLFKDLSK
Download sequence
Identical sequences ENSPANP00000016450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]