SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016495 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016495
Domain Number 1 Region: 288-418
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-44
Family Regulator of G-protein signaling, RGS 0.000000146
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.28e-28
Family DEP domain 0.01
Further Details:      
 
Domain Number 3 Region: 225-279
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000523
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016495   Gene: ENSPANG00000020610   Transcript: ENSPANT00000026914
Sequence length 674
Comment pep:known_by_projection chromosome:PapAnu2.0:16:56827680:56918476:1 gene:ENSPANG00000020610 transcript:ENSPANT00000026914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIV
QRLWISNLEAQNLGNFIVRYGYIYPLQDPKNLVLKPDGSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYAL
DCQEKAYWLVHRCPPGMDNVLDYGLDRVTNPNEVKVNQKQTVIAVKKEIMYYQQALMRST
VKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWA
FNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAP
GARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKA
IEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHL
TVYTGTCVPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALETSSGLEQKG
ECSGSMAPRGPSVTESSEASLDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLS
PKCPAVSHGRVQPLGDVGQQLPRLKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGD
RATEKEVICPWESL
Download sequence
Identical sequences ENSPANP00000016495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]