SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016497 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016497
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.66e-38
Family Regulator of G-protein signaling, RGS 0.00000514
Further Details:      
 
Domain Number 2 Region: 756-836
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-26
Family DIX domain 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016497   Gene: ENSPANG00000020613   Transcript: ENSPANT00000025408
Sequence length 836
Comment pep:known_by_projection chromosome:PapAnu2.0:16:57214471:57246548:-1 gene:ENSPANG00000020613 transcript:ENSPANT00000025408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAMLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQLGVGKGQVTKPVPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHNLEERLQQIREDEEKEGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPSQYHSLLPPGGKL
PPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGP
EYYCYSKCKSHPKALETMPGEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGAMQ
LPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNS
AHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHS
ATVQAGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLT
LGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
Download sequence
Identical sequences ENSPANP00000016497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]