SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016499 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016499
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.61e-21
Family Complement control module/SCR domain 0.00000348
Further Details:      
 
Domain Number 2 Region: 83-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-16
Family Complement control module/SCR domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000124
Family Complement control module/SCR domain 0.00002
Further Details:      
 
Domain Number 4 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0000332
Further Details:      
 
Domain Number 5 Region: 22-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000054
Family Complement control module/SCR domain 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016499   Gene: ENSPANG00000020563   Transcript: ENSPANT00000024916
Sequence length 345
Comment pep:known_by_projection chromosome:PapAnu2.0:16:57894882:57916004:-1 gene:ENSPANG00000020563 transcript:ENSPANT00000024916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IETDSLILLCVKLLHILIIGNTCPKPDDLPFSIVVPLKTFYQPGEEITYSCKPGYVSRGG
MRRFICPLTGMWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTINFSCNTGFYLNGAN
SAKCTEEGQWSPGIPVCAPITCPPPSVPMFATLRVYKPSAGNNSFYQDTAVFECLPQHAM
FGNDTITCTTHGNWTKLPECREVKCPFPLRPDNGFVNYPAKPVLYYKDKATFGCHDGYSL
DGPEEIECTKLGNWSAMPSCKASCKVPVKRATVVYQGERVKIQEKFKNGMLHGDKVSFFC
KNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences ENSPANP00000016499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]