SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016504
Domain Number 1 Region: 64-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-69
Family Glutathione peroxidase-like 0.0000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016504   Gene: ENSPANG00000020609   Transcript: ENSPANT00000023825
Sequence length 256
Comment pep:known_by_projection chromosome:PapAnu2.0:9:110763528:110775942:-1 gene:ENSPANG00000020609 transcript:ENSPANT00000023825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSY
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPADWTPDSPTI
KPNPAASKEYFQKVNQ
Download sequence
Identical sequences A0A096NTY3 A0A0D9QXJ1 A0A2K5ZL63 A0A2K6R177
ENSPANP00000016504 XP_007962436.1.81039 XP_010374276.1.97406 XP_011715764.1.29376 XP_011856487.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]