SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016507 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016507
Domain Number 1 Region: 450-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-58
Family Tandem AAA-ATPase domain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016507
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.022
Family CCCH zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016507   Gene: ENSPANG00000020569   Transcript: ENSPANT00000006071
Sequence length 1759
Comment pep:known_by_projection chromosome:PapAnu2.0:16:58760021:58874725:-1 gene:ENSPANG00000020569 transcript:ENSPANT00000006071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQNENKQLSGSYMETLIEKWMN
SLSPEKVLSECIEGVKVEHNPDLSVTVSTKKSHQTWTFALTCKPARMLYRVALLYDAHRP
HFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGTFRQTI
VFDFGLEPVLMQRVMIDAASTEVDLEYLMHAKQQLVTTAKRWDSSSKTIIDFEPNETTDL
EKSLLIRYQIPLSADQLFTQSVLDKSLTKSNYQSRLHDLLYIEEIAQYKEISKFNLKVQL
QILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTKVNAVYLLPVPKQKL
GQTQGTKEKVYEATIEEKTKEYIFLRLSRECCEELNLRPDCDTQVELQFQLNRLPLCEMH
YALDRIKDNGVLFPDISMTPTIPWSPNRQWDEQLDPRLNAKQKEAVLAITTPLAIQLPPV
LIIGPYGTGKTFTLAQAVKHILQQQETSRILICTHSNSAADLYIKDYLHPYVEAGNPQAR
PLRVYFRNRWVKTVHPVVHQYCLISSAHSTFQMPQKEDILKHRVVVVTLNTSQYLCQLDL
EPGFFTHILLDEAAQAMECETIMPLALATQNTRIVLAGDHMQLSPFVYSEFARERNLHVS
LLDRLYEHYPAEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYPLTFF
TARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQVFRI
RAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKKKEQLLEDSTEDL
DYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSIGRCRKFWERFIALCHENNSLHGITFE
QIKAQLEALELKKTYVLNPLAPEFIPRALRLQHSGSTNKQQQSPPKGKSLHHTQNDHFQN
DGIVQPNPSVLIGNPIRAYTPPPPLGPHPNLGKSPSPVQRIDPHTGTSILYVPAVYGGNV
VMSVPLPVPWTGYQGRFAVDPRIITHQAAMAYNMNLLQTHGRGSPIPYGLGHHPPVSIGQ
PQNQHQEKDQHEQNRNGKSDTNNSGPEITKIRTPEKKPTEPKQVDLESNPQNRSPESRPS
VVYPSTKFPRKDNLNPRHINLPLPAPHAQYAIPNRHFHPLPQLPRPPFPIPQQHTLLNQQ
QNNLPEQANQMPPQPNQVVQQQSQLNQQPQQPPPQLSPAYQAGPNNAFFNNAVAHRPQSP
PAEAVISEQQPPPMLQEGHSPLRAITQPGPILPSHLNSFIDENPPGLPIGEALDRIHGSV
ALETLRQQQARFQQWSEHHAFLSQGSVPYPHHHHPHLQHLPQPPLGLHQPPVRADWKLTS
SAEDEVETTYSRFQDLIRELSHRDQSETRELAEMPPPQSRLLQYRQVQTRSPPAVPSPPS
STDHSSHFSNFNDNSRDIEVASNPAFPQRLPPQIFSSPFSLPSEHLAPPPLKYLAPDGAW
TFANLQQNHLMGPGFPYGLPPLPHRPPQNPFVQIQNHQHAIGQEPFHPLSSRTVSSSSLP
SLEEYEPRGPGRPLYQRRISSSSVQPCSEEVSTPQDSLAQCKELQDHSNQSSFNFSSPES
WVNTTSSTPYQNIPCNGSSRTAQPRELIAPPKTVKPPEDQLKSENLEVSSSFNYSVLQHL
GQFPPLMPNKQIAESANSSSPQSSAGGKPAMSYASALRAPPKPRPPPEQAKKSSDPLSLF
QELSLGSSSGSNGFYSYFK
Download sequence
Identical sequences ENSPANP00000016507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]