SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016510 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016510
Domain Number 1 Region: 23-162
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.19e-40
Family Regulator of G-protein signaling, RGS 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016510   Gene: ENSPANG00000020561   Transcript: ENSPANT00000023823
Sequence length 181
Comment pep:known_by_projection chromosome:PapAnu2.0:9:111093268:111136593:-1 gene:ENSPANG00000020561 transcript:ENSPANT00000023823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLK
KEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILE
EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDSPDAQTAAKRASRIYN
T
Download sequence
Identical sequences A0A2I3H499 A0A2I3MJ81 A0A2J8W6Q8 A0A2K5LXL6 A0A2K5VBE2 A0A2K6D1L1 F7E433 H2Q2N8
ENSPTRP00000005281 ENSPANP00000016510 ENSMMUP00000028465 ENSNLEP00000020310 XP_003255074.1.23891 XP_003825697.1.60992 XP_005566626.1.63531 XP_011715833.1.29376 XP_011898492.1.92194 XP_015003652.1.72884 XP_016774974.1.37143 ENSNLEP00000020310 9544.ENSMMUP00000028465 9598.ENSPTRP00000005281 ENSPTRP00000005281 ENSMMUP00000035599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]