SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016514 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016514
Domain Number 1 Region: 695-756
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-17
Family PHD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 758-812
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-17
Family PHD domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016514
Domain Number - Region: 642-653
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016514   Gene: ENSPANG00000020520   Transcript: ENSPANT00000023029
Sequence length 872
Comment pep:novel chromosome:PapAnu2.0:16:59490623:59524429:1 gene:ENSPANG00000020520 transcript:ENSPANT00000023029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPISGSVTTGTKMVLTTKVGSPATVTFQQNKNFHQTFATWVKQGQSNSATSTAATSAT
TIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGVVQVQQKVLGIIPSS
TGTSQQTFTSFQPRTATVTIRPNTSGSGGTTSNSQVITGPQIRPGMTVIRTPLQQSTLGK
AIIRTPVMVQPGAPQQVMTQIIRGQPVSTAISAPNTVSSTPGQKSLTSATSTSNIQSSAS
QPPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTTGQLQLIPQGVTVLPGPGQQ
LMQAAMPNGTVQRFLFTPLATTATTASTTTTTVSTTAAGTGEQRQSKLSPQTQVHQDKTL
PPAQSSSVGPAEAQPQTAQPSAQPQPQTQPQSPAQPEVQTQPEVQTQTTVSSHVPSEAQP
TQAQSSKPQVAAQSQPQSNVQGQSPVRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPI
PIQPHTSLQIPSQGQPQSQPQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQVMKYI
LDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQ
IEVQEELKRDLKIKKEKDLMQVAQSTAVAVPCPPVTAAPPAPPAPPPSPPPPPAVQHTGL
LSTPTLPAASQKRKREEEKDSSSKSKKKKMISTTSKETKKDTKLYCICKTPYDESKFYIG
CDLCTNWYHGECVGITEKEAKKMDVYICNDCKRAQEGSSEELYCICRTPYDESQFYIGCD
RCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQVR
PLCVQHLKMKSASIILERFLGFQLSSLKVIIY
Download sequence
Identical sequences ENSPANP00000016514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]