SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016542 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016542
Domain Number 1 Region: 449-552
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 2 Region: 48-153
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000041
Further Details:      
 
Domain Number 3 Region: 817-925
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000439
Further Details:      
 
Domain Number 4 Region: 578-682
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 5 Region: 190-293
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 6 Region: 324-430
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 7 Region: 709-814
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 8 Region: 1067-1162
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 9 Region: 949-1061
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 10 Region: 1191-1300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016542   Gene: ENSPANG00000020483   Transcript: ENSPANT00000023821
Sequence length 1597
Comment pep:known_by_projection chromosome:PapAnu2.0:9:114161169:114216231:1 gene:ENSPANG00000020483 transcript:ENSPANT00000023821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGEWRVLATCLLWDPVPSAEKLHPLCTQLDSGISIPITSTGVTGSESSLALRLVNGGNRC
QGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
SGQESYLWNCPHNGWLSHNCGHHEDAGVICSAAQSWSTPKPDVLPTTTLPASTPMHCRGV
KIIFKGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDASVVCRQLGCGWAT
SAPGSARFGQGSGPIVLDDVRCSGNESYLWNCPHNGWLSHNCGHHEDAGVICTVKDALPT
TTLSALTVGMDEEFLCSPVGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTND
ANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVHCSGYESYLWNCPHRGWLSHNCGHHE
DAGVICSGCLPCPETFPFGAFHPQGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDS
WDINDANVVCRQLGCGWAISAPGNARFGQGSGPIVLDDVRCSGNESYLWNCPHNGWLSHN
CGHSEDAGVICSVSQSQSTPGPDTWLTSPASTAGSESSLALRLVNGGDRCQGRVEVLYQG
SWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWNC
PHRGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLLTPPIGTESSLALRLVNGGDR
CQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVR
CSGQESYLWNCPHRGWLSHNCGHHEDSGVICSGTESSLALRLVNGGDRCQGRVEVLYQGS
WGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGQESYLWNCP
HRGWLSHNCGHHEDAGVICSDTWLTTNLLTPPIDWWHPTTTITTRPSSNCGGFLFSASGT
FSSPSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLQLEAHYNCSFDYVEIFDGSLNSSHL
LGKICNDTRQIFTSSYNRMTIHFRSDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCA
GRVEIYHGGTWGTVCDDSWTIHEAEVVCRQLGCGRAVSALGNAYFGAGSGPITLDDVECS
GTESTLWQCRNRGWFSHNCRLHQGSRKTDPILFFLSTAPFLNATRSNTNYSCGGFLSQPS
GDFSSPFYPGNYPNNAKCVWDIEVRNNHRVTVVFRDVQLEGGCSYDYVEVFDGPYHSSPL
IARVCDGARGSFTSSSNFMSIRFVSDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASV
SRSYLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYSGCGTFKQVDNDTIDYSNF
LTAAHVASRGIITRRKNFRIHLSCRMLQNTWVNTMYIANDTIQVKEVQYGNFDVNISFYT
SSSFLYPVTSHPYYVKLNQDLYVQAEILHSDAALTLFVDTCVASPYSNDFTSLNYDLIRS
GCVRDDTYGSYSQPSPRIARFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCNRGCVMR
SKRDVGSYQEKDVVLGPIQLQTPPRLEEEPHAGRGQE
Download sequence
Identical sequences ENSPANP00000016542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]