SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016543 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016543
Domain Number 1 Region: 28-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016543   Gene: ENSPANG00000020484   Transcript: ENSPANT00000012221
Sequence length 138
Comment pep:novel chromosome:PapAnu2.0:9:114251607:114255612:1 gene:ENSPANG00000020484 transcript:ENSPANT00000012221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHAGLAWIQLLVSSATTVTAPFATAPSDCGGHYTDEYGRIFNYVGPKTECVWIIELNP
GDIVTVAIPELKPRGFVCGKEYVEVLDGPPGSESLGRICEAFSTFYHSSSNIITIKYSRE
PSHPPTFFEIYYFVDAWS
Download sequence
Identical sequences ENSPANP00000016543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]