SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016545 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016545
Domain Number 1 Region: 83-188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000484
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016545   Gene: ENSPANG00000020487   Transcript: ENSPANT00000022796
Sequence length 530
Comment pep:known_by_projection chromosome:PapAnu2.0:9:114392780:114435294:-1 gene:ENSPANG00000020487 transcript:ENSPANT00000022796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPDGSCESENIKVFDGTSSNGPLLGQVCSKNDYVPVFESSASTLTFQIVTDSARIQRT
VFVFYYFFSPNTSIPNCGGYLDTLEGSFTSPNYPNPHPELAYCVWHIQVEKGYKIKLNFK
EIFLEIDKQCKFDFLAIYDGPSTNSGLIGQVCGRVTPTFESSSNSLTVVLSTDYANSYRG
FSASYTSIYAENINTTSLTCSSDRMRVIISKSYLEAFNSNGNTLQLKDPTCRPKLSNVVE
FSIPLNGCGTIRKVEDQSITYTNIITFSASSPSEVITRQKQLQIIVKCEMEHNSTVGLIY
ITEDDVIQNQNALGKYNTSMALFESDSFEKTILESPYYVDLNQTLFVQVSLHTSDPNLVV
FLDTCRASPTSDLASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSLSSVYLQ
CKVLICDSSDYQSRCSQGCVSRSKRDISSYKWRTDSIIGPIRLKRDRSASGNSGFQHETH
AEETPNQPFNSLHLFSFMVLVLNVVIVATITVRHFVNQQAYYKYQKLQNY
Download sequence
Identical sequences ENSPANP00000016545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]