SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016578 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016578
Domain Number 1 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000012
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number 2 Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016578
Domain Number - Region: 147-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00275
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 120-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0419
Family CCCH zinc finger 0.0068
Further Details:      
 
Domain Number - Region: 92-117
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0785
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016578   Gene: ENSPANG00000020331   Transcript: ENSPANT00000024913
Sequence length 180
Comment pep:known_by_projection chromosome:PapAnu2.0:16:64649027:64661812:-1 gene:ENSPANG00000020331 transcript:ENSPANT00000024913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVIAGLERFTFAFEEDVEMQKGTGLLPFPGMDKSASAVCNFFAKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDITRMPECYFYSKFGDCSNKECPFLHVKPAFK
SQDCPWYDQGFCKDAGPLCKYRHVPRIMCLNYLVGFCPEGPKCRFSQKIREFKLLPGSKI
Download sequence
Identical sequences ENSPANP00000016578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]