SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016581 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016581
Domain Number 1 Region: 32-215
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.94e-29
Family CAC2371-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016581   Gene: ENSPANG00000020335   Transcript: ENSPANT00000022341
Sequence length 236
Comment pep:novel chromosome:PapAnu2.0:9:116302190:116337937:-1 gene:ENSPANG00000020335 transcript:ENSPANT00000022341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDADGGSGAEVAALSDKDSPGEDGFVPSALGTREHWDAVYERELQTFREFGDTGEIWF
GEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSDITGIDYSPSAIQLSGS
VIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRV
LKVKGFFLITSCNWTKEELLNEFSEGFELFEELPTPKFSFGGRSGNSVAALVFQKM
Download sequence
Identical sequences A0A096NU60 A0A2K5LJE3
ENSPANP00000016581 XP_011898643.1.92194 XP_011898644.1.92194 XP_011898645.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]