SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016594 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016594
Domain Number 1 Region: 185-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-81
Family Protein kinases, catalytic subunit 0.000000432
Further Details:      
 
Domain Number 2 Region: 31-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.39e-42
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016594   Gene: ENSPANG00000015062   Transcript: ENSPANT00000004474
Sequence length 578
Comment pep:known_by_projection chromosome:PapAnu2.0:1:958110:1034158:-1 gene:ENSPANG00000015062 transcript:ENSPANT00000004474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIMANSLLLKARQGGYGKKSGRSKKWREILTLPPVSQCSELRHSIEREYNSLCDKQ
PIGRLLFRQFCDTKPTLKRHIEFLDAVADYEVANDEDRSDYGLSILDIFFNDKLAAPLPE
IPPDVVRECRLGLKEENPSKKVFEECTRVTHNYLRGEPFEEYQESSYFSQFLQWKWLERQ
PVTKNTFRHYRVLGKGGFGEVCACQVRATGKMYACKKLQKKRIKKRKGEAMALNEKRILE
KVQSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFYAAELCCGL
EDLQRERIVYRDLKPENILLDDRGHIRISDLGLAMEIPEGQMARGRVGTVGYMAPEVVNN
EKYTFSPDWWGLGCLIYEMIQGHSPFKKYKEKVKREEIDQRIKNDTEEYSEKFSEDAKSI
CRMLLTKNPSKRLGCRGEGAAGVKQHPVFKNINFRRLEANMLEPPFCPDPHAVYCKDVLD
IEQFSAVKGIYLDTADEDFYAQFATGCVSIPWQNEMIESGCFKDINKSEREKALPLDLDK
NIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKRC
Download sequence
Identical sequences A0A096NU73
ENSPANP00000016594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]