SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016637 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016637
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000268
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016637   Gene: ENSPANG00000006081   Transcript: ENSPANT00000007366
Sequence length 169
Comment pep:known_by_projection chromosome:PapAnu2.0:5:54514023:54537565:-1 gene:ENSPANG00000006081 transcript:ENSPANT00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGRRMEMLSAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCNSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFYLTVHQPLSKEYVA
LTVILIILFLIIVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Download sequence
Identical sequences A0A096NUB3 A0A2K5NHP2 A0A2K5ZVH3 A0A2K6DB20 F7D8Y3 G7P5K3
ENSMMUP00000003090 XP_001102069.1.72884 XP_005555120.1.63531 XP_011732040.1.29376 XP_011821545.1.47321 XP_011895824.1.92194 ENSMMUP00000003090 ENSPANP00000016637 9544.ENSMMUP00000003090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]