SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016643 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016643
Domain Number 1 Region: 1171-1303
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-47
Family Ran-binding domain 0.000000294
Further Details:      
 
Domain Number 2 Region: 2310-2440
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-45
Family Ran-binding domain 0.0000459
Further Details:      
 
Domain Number 3 Region: 2907-3044
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-44
Family Ran-binding domain 0.0000306
Further Details:      
 
Domain Number 4 Region: 2012-2143
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-44
Family Ran-binding domain 0.00000107
Further Details:      
 
Domain Number 5 Region: 31-191
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000141
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 6 Region: 1606-1632
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000017
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 
Domain Number 7 Region: 1724-1750
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000034
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 8 Region: 1665-1691
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000419
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 9 Region: 1415-1442
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000785
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 10 Region: 1479-1506
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000131
Family Ran binding protein zinc finger-like 0.0021
Further Details:      
 
Domain Number 11 Region: 1543-1569
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000361
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 12 Region: 1781-1809
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000549
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016643
Domain Number - Region: 1354-1380
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00115
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016643   Gene: ENSPANG00000000990   Transcript: ENSPANT00000011308
Sequence length 3053
Comment pep:novel chromosome:PapAnu2.0:13:99938311:100005616:1 gene:ENSPANG00000000990 transcript:ENSPANT00000011308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSKADVERYIASVQGSAPSPREKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSNKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLECLESDKSDWRATNTDLLLAYA
NLTLLTLSTRDVQESRELLESFDSALQSVKSSLGGNDELSATFLEMKGHFYMHAGSLLLK
MGQHSDVQWRALSQLAALCYLIAFQVPRPKIKLIKGETGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEIVESFANKSGQSALYDALFSSQSPKDTSFLGSDSIGNIDVQEPELEDLA
RYDVGAIRAHNGSLQHLTWLGLQWNSLPALPAIRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSYHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIH
RKAVPGNSAKLRLLVQHEINTLRAQEKHGLQPALLIHWAKCLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIGAYEEDAHITFAILDAV
NGNIEDAMTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIK
ILDDSDSNLSVVKKLPVPLESVKEMLNSVMQELEDYSEGGPLYKNGSSRNADSEIKHSTP
SPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHR
WPTESYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPATGILSPRGDD
YFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIEFGKTNFVQPMPGEGIRPSLP
TPAHTTQPPPFKFNSNFKSNDGDFTFSSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDG
YSGPKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSAQQKNSGFRRSDDMFTFRGPGKS
VFGTPTLETANKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAK
LFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGS
DRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKAPGTNVATASNQAI
RIVKEPTSHDNKDICKSDAGNMNFEFQVGKKEGSWWHCNSCSLKNAATAKKCVSCQNLNP
SNKELVGPPLAETVFTPKTGPENIQDRFALMTPKKEGHWDCSICLVRNEPTVSRCIACQN
TKSANKSGSSFVHQASFTFGQGDLPKPVNSDFRSVFSTKEGQWECSVCLVQNEGSSTKCA
ACLNPRKQSLPATAIPTPASFKFGTSETSKTPKSGFEDMFAKKEGQWDCSSCLVRNEANA
TRCVACQNPDKPSPSTSVPAPASFKFGTSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNE
ASATKCIACQNPGKQNQTASAISTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLLRNEA
SATKCIACQNPGKQNQTTTAISTPASSETSKAPKSGFEGMFTKKEGQWDCSMCLVRNEAS
ASKCIACQYPSKQNQTTAISTPTSSEVSKAPKSGFEGMFIKKGQWDCSVCCVQNESSSLT
CVACDASKPSHKPIAEAPSAFTLGSETKLHDSSGSQVGTGFKSNFSEKAFKFGNTEQGFK
FGHVDQENSPSFMFQGSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKSEKPLENDS
GFQAQDISSQKNGSGVIFGQTSSTFTFADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLFS
SQCGKMADKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRV
KLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSG
SDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDT
GRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTEEENKNSGTGSASASDTTIKPNPENTGP
TLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKS
PAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLY
RYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTER
VWVWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSGTPR
ESPCGKIAVAVLEETTRERTDVIQGDDVADATSEVEVSSTSETTTKAVVSPPKFVFGSES
VKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPNKCELS
KNSDTEQSSDSKVKNLFASFPTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTP
TAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLE
ENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKV
QEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSTTKSISSPSVSSETMDKPVDLS
TRKELDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVF
GTQSVGTQSIGKVGEDEDGSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKL
YRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSN
NALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLLQLQKGHVA
Download sequence
Identical sequences ENSPANP00000016643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]