SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016681 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016681
Domain Number 1 Region: 139-258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 244-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000013
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 15-70,112-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016681
Domain Number - Region: 286-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016681   Gene: ENSPANG00000007668   Transcript: ENSPANT00000016505
Sequence length 448
Comment pep:known_by_projection chromosome:PapAnu2.0:7:147994805:148076253:-1 gene:ENSPANG00000007668 transcript:ENSPANT00000016505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
EGNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFVCRCDPGYELEE
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCN
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences A0A2K5LFF1 A0A2K5VLH4 A0A2K5Y245 A0A2K6CT03 I0FNH4
ENSPANP00000016681 NP_001247463.1.72884 XP_005562096.1.63531 XP_011715524.1.29376 XP_011847166.1.47321 XP_011847167.1.47321 XP_011939097.1.92194 ENSMMUP00000011079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]