SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016691 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016691
Domain Number 1 Region: 16-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000135
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016691
Domain Number - Region: 252-283
Classification Level Classification E-value
Superfamily SAP domain 0.000183
Family SAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016691   Gene: ENSPANG00000008855   Transcript: ENSPANT00000008246
Sequence length 505
Comment pep:known_by_projection chromosome:PapAnu2.0:2:51226036:51306060:1 gene:ENSPANG00000008855 transcript:ENSPANT00000008246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAEPQWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQLTLESPPKSPASSSSKNLAVKVYTPV
ASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFTSQKEASPAAKTKETRSVEEMAP
DPSEVKRPETPSTSTLKHITKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKR
KPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
VQEIENMEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKCEFQLLVDQARKG
YKKIVGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVINHFSQSKLVTNHFSQSKLDSA
EELEPDREEDSSSCTDIQEALSSPESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEI
SPRQNRRTRAAESAEIEPRNKRNRN
Download sequence
Identical sequences A0A096NUG7
ENSPANP00000016691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]