SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016709 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016709
Domain Number 1 Region: 272-624
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.89e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000222
Further Details:      
 
Domain Number 2 Region: 121-264
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-38
Family Anticodon-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016709   Gene: ENSPANG00000024106   Transcript: ENSPANT00000013802
Sequence length 647
Comment pep:known_by_projection chromosome:PapAnu2.0:20:57365917:57385793:-1 gene:ENSPANG00000024106 transcript:ENSPANT00000013802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAALSLRNSSRSAMKAPAPSPPEEVGPRTLTWKLTYYPPYIWVGPSGKMAAVQAAEVK
VDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATVAATSHTTDNGVGPEEES
LDPNQYFKIRSQAIHQLKVNGENPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAG
RIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGK
TKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKM
ITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKILVVG
GIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDVMEITEKMVSGMVKHITGSYK
ITYHPDGPEGQAYDIDFTPPFRRISMIEELEKALGMKLPETNLFETEETRKILDDICVAK
AVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFV
MKKEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTGGFGMG
LDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
Download sequence
Identical sequences A0A096NUI5
ENSPANP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]