SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016726 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016726
Domain Number 1 Region: 91-194
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-32
Family SH2 domain 0.000047
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000669
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016726   Gene: ENSPANG00000025054   Transcript: ENSPANT00000013581
Sequence length 261
Comment pep:known_by_projection chromosome:PapAnu2.0:10:27528506:27558485:1 gene:ENSPANG00000025054 transcript:ENSPANT00000013581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLPSRRKSLPSPSLSPSVQGQGPVTTEAERSKATAVALGSFPAGGPAELSLRLGEPLT
IVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGSYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPSLQALVDHYSELA
DDICCLLKEPCVLQRAGPLPSKDIPLPVTVQRTPLNWKELDSSLLFSEVPTGEESLLSEG
LRESLSSYISLNEEAVSLDDA
Download sequence
Identical sequences A0A096NUK2 A0A2K5TX62 A0A2K6AIK4 A0A2K6CQM2 G7N4X4
ENSPANP00000016726 NP_001248053.1.72884 XP_005568988.1.63531 XP_005568989.1.63531 XP_011764914.1.29376 XP_011764915.1.29376 XP_011827738.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]