SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016739 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016739
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.08e-19
Family MBT repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 643-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000204
Family PHD domain 0.0046
Further Details:      
 
Domain Number 3 Region: 86-137
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000274
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016739   Gene: ENSPANG00000019314   Transcript: ENSPANT00000015224
Sequence length 1013
Comment pep:known_by_projection chromosome:PapAnu2.0:10:28241346:28427615:-1 gene:ENSPANG00000019314 transcript:ENSPANT00000015224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCW
DSPYLRPLEKIQLRKEGLHEEDGSSEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKF
YDGVVQTVKHIHVKAFSKDQNIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDK
EDKPLKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENDREYSGDAQVDKK
PENDIVKSPQENLREPKRKRGRPPSIAPTAVDSNSQTLQPITLELRRRKISKGCEVPLKR
PRLDKNSSQEKSKNYSENTDRDLSRRRSSRLSTNGTHEILDPDLVVSDLVDTDPLQDTLS
STKESEEGQLKSTLEAGQVSSALTCHSFGDGSGAAGLELNCPSMGENTMKTETTSPLVEL
QEISTVEAVTNTFKKTDDFVSSNAPAVDLDHKFRCKVVDCLKFFRKAKLLHYHMKYFHGM
EKSLEPEESPGKRHVQTRGPSASDKPSQETLTRKRVSASSPSNSTKEHDNQKETRPFHVG
RKAHKQREKDPVLPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESG
HHKGKGKALEEDNLSESSSESFLWSDDEYGQDVDVTTNPDEELDGDDRYDFEVVRCICEV
QEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDPPGQRPGFKYWYDKEWLSRG
HMHGLAFLEENYSHQNAKKIVATHQLLGDVQRVIEVLHGLQLKMSILQSREHPDLPLWCQ
PWKQHSGEGRSQFKNIPVTDTRSKEEAPSYRTLNGAVEKPRPLALPLPRSVEESYITSEH
CYQKPRAYYPAVEQKLVVETRGSALDDAVNPLHENGNDSLSPRLGWPLDQDRSRGDSDPK
PSSPKVKEYVSKKALPEEAPARKLLDRGGEGLLSSQHQWQFNLLTHVESLQDEVTHRMDS
IEKELDVLESWLDYTGELEPPEPLARLPQLKHCIKQLLTDLGKVQQIALCCST
Download sequence
Identical sequences ENSPANP00000016739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]