SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016788 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016788
Domain Number 1 Region: 324-608
Classification Level Classification E-value
Superfamily TPR-like 8.16e-44
Family HAT/Suf repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 87-262
Classification Level Classification E-value
Superfamily TPR-like 1.67e-36
Family HAT/Suf repeat 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016788   Gene: ENSPANG00000023258   Transcript: ENSPANT00000015700
Sequence length 669
Comment pep:known_by_projection chromosome:PapAnu2.0:7:101708086:101739593:1 gene:ENSPANG00000023258 transcript:ENSPANT00000015700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSHMDEYRNSSNGSTGNSSEVVVEHPTDFSTEIMNVTEMEQSPDDSPNVNASTEESEM
ASAVDLPVTLTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDR
FFIHYPYCYGYWKKYADLEKRHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPG
DPETNNTIRGTFEHAVLAAGTDFRSDRLWEMYINWENEQGNLREVTAIYDRILGIPTQLY
SHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGPPGDDLPSGIEDITDPA
KLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEYL
EFEIENGTHERVVVLFERCVISCALYEEFWIKYAKYMENHSIEGVRHVFSRACTIHLPKK
PMVHMLWAAFEEQQGNINEARNILRTFEECVLGLAMVRLRRVSLERRHGNLEEAEHLLQD
AIKNAKSNNESSFYAVKLARHLFKIQKNLPKSRKVLLEAIERDKENTKLYLNLLEMEYSG
DLKQNEENILNCFDKAVHGSLPIKMRITFSQRKVEFLEDFGSDVNKLLNAYDEHQTLLKE
QDSLKRKAENGSEEPEEKKAHTEDTTSSSTQMIDGDLQANQAVYNYSAWYQYNYQNPWNY
GQYYPPPPT
Download sequence
Identical sequences A0A096NUR4 A0A2K5JFF5 A0A2K6A8Y9 A0A2K6QHT3 G7PA61 H9FWE5
ENSPANP00000016788 XP_005561233.1.63531 XP_007984775.1.81039 XP_007984776.1.81039 XP_010387599.1.97406 XP_011739986.1.29376 XP_011802462.1.43180 XP_011851626.1.47321 XP_011942559.1.92194 XP_014999107.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]