SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016823 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016823
Domain Number 1 Region: 266-353
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 2.55e-16
Family PA3566-like 0.02
Further Details:      
 
Domain Number 2 Region: 28-105
Classification Level Classification E-value
Superfamily EF-hand 0.00000000223
Family Polcalcin 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016823   Gene: ENSPANG00000025546   Transcript: ENSPANT00000011825
Sequence length 368
Comment pep:known_by_projection chromosome:PapAnu2.0:10:30554458:30573123:1 gene:ENSPANG00000025546 transcript:ENSPANT00000011825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACVGLLTVCLLRPPAPQPQPQPQPQPQPPRHPQLAPDPGPAGHALFQDVFRRADKNDDG
KLSFEEFQNYFADGVLSPGELQELFSGIDGHLTDNLETEKLCDYFAEHLGVYRPVLAALE
SLNRAVLAAMDATKLAYERASKVNQFVTRFLLRETVSQLQALQSSLEGASDTLEAQARGW
RSDAESVEAQSRPCGSRRTGRRALRSVSRSSTWSPGSSDTGHSSEAEMQWQLQVNRLQEL
IDQLECKAPRLEPLHEEDLAKGPDSHILVAQRQVQVAEEGLQDFHRALRCYVDFTGAQSH
CLHVSAQKMPDGASFTLYEFWQDEASWRRHQQSPCSKAFQRVLIDHLRAPDTLTTVFFPA
SWWIMNNN
Download sequence
Identical sequences ENSPANP00000016823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]