SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016852 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016852
Domain Number 1 Region: 7-84,178-248
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000128
Family Calmodulin-like 0.089
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016852
Domain Number - Region: 1568-1617
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.000327
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0023
Further Details:      
 
Domain Number - Region: 223-348
Classification Level Classification E-value
Superfamily EF-hand 0.00833
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016852   Gene: ENSPANG00000001131   Transcript: ENSPANT00000013595
Sequence length 1777
Comment pep:known_by_projection chromosome:PapAnu2.0:7:107243162:107327474:-1 gene:ENSPANG00000001131 transcript:ENSPANT00000013595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLG
RVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEF
AEVTVIEPLDEEARPSHIPASDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQ
DWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQSVDGEMLEEVFHNLDPDGTMSVE
DFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTPSAMTSTIGFRVFSCLDD
GMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENELLVTKNSIHQA
ALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR
KLDEEYKERIAALKNELRKEREQILQQAGKQRLELEQEIEKAKTEENYIRDRLALSLKEN
SRLENELLENAEKLGEYENLMNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEY
EQQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSLSEEIDANSGGIEPDQGLGSEECNP
LNMSIEAELVIEQMKEQHHRDICCLRLELEDKVHHYEKQLDETIVTCKKAQENMKQRHEN
EMHTLEKQISDLKNEIAELQGQAAVLKEAHHEATCRHEEEKKQLQAKLEEEKTHLQEKLR
LEHEMELKARLAQAQASFEQEREGLQSRAWAEEKVRGLTQELERFHQEQLTSLVEKHTLE
KEELRKELLEKHQKELQEGREKMETECNRRTSQIEAQFQSDCQKVTERCESALQSLEGRY
RQELKDLREQQREEKSQWEFEKDELAQECAEAQELLKETLKREKATSLVLTQEREMLEKT
YEEHLNSMVVEREQLLQDLEDLRNVSETQQSLLSDQILELKSSHERELREREEALCQAGA
SEQLASQRLERLEMEHDQERQEMMSKLLAMENIHKTTCEKADRERAEMSTEISRLKSKIK
EMQQAASPLSMLQSGSQVIGEEEVEGDGALSLLQQGEQLLEENGDVLLSLQRAHEQAVKE
NVKMATEISRLQQRLQKLEPGLVMSSCLDEPATEFFGDAAEQTEPFLQQNRTKQVDGVTR
RHVLSDLEDDEVRDLGSTGTSSVQRKEVKIEESEASVEGFSELENSEETRTESWELKNQI
SQLQEQLMMLCADCDRASEKKQDLLFDVSVLKKKLKMLERIPEASPKYKLLYEDVSQEND
CLQEELRMMETRYDEALENNKELTTEVFRLQDELKKMEEVTETFLSLEKSYDEVKIENEE
LNVLVLRLQGKIEKLQESMVQRCDCCLWESSLENLEVEPDGNILQLNQTLEECVPRVRSV
HHVIEECKQENQYLEQGNTQLLEKVKAHEIAWLHGTIQTHQERPRVQNQVILEENTTLLG
FQDKHFQRQATIAELELEKTKLQELTRKLKERVTILVKQKDVLSQGEKEEELKAMMHDLQ
ITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLGKLNGSQEEMWQKTE
TVKQENAAVQKIVENLKKQISELEIKNQQLDLENTELSQKNSQNQEKLQELNQRLTEMLC
QKEKEPGNSALEEQEQEKFNLKEELERCKVQSSTLVSSLEAELSEIKIQTHIVEQENLLL
KDELEKMKQLHRCPDLSDFQQKVSSVLSYNEKLLKEKEALSEELNSCIDKVVKIIRLCHH
RIHTHHNEPFSVNSGTGAFCGSLLFQSVLEQHFFGIL
Download sequence
Identical sequences ENSPANP00000016852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]