SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016867 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016867
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-28
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 228-370
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000227
Family First domain of FERM 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016867   Gene: ENSPANG00000016047   Transcript: ENSPANT00000018821
Sequence length 622
Comment pep:known_by_projection chromosome:PapAnu2.0:7:108148304:108224900:1 gene:ENSPANG00000016047 transcript:ENSPANT00000018821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMEMSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSAGSMKHKRLSRHSTTSHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRDLEQMNEEPLEVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences ENSPANP00000016867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]