SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016879 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016879
Domain Number 1 Region: 394-494
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-17
Family PDI-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016879
Domain Number - Region: 27-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00242
Family PDI-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016879   Gene: ENSPANG00000007166   Transcript: ENSPANT00000007844
Sequence length 753
Comment pep:known_by_projection chromosome:PapAnu2.0:7:108849569:108955487:-1 gene:ENSPANG00000007166 transcript:ENSPANT00000007844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSGFSVFRVGISFVIMCSFYMPTVDSLLELSPQKYFSTLQPGKASLAYFCQADSPRTS
VFLEELNEAVRPLQDYGISVAKVNCVKEEISRYCGKEKDLMKAYLFKGNILLREFPTDTL
FDVNAIVAHVLFALLFNEVKYITNLEDLQNIENALKGKANIIFSYVRAIGIPEHRAVMEA
AFVYGTTYQFVLTTEIALLESLGSEDVEYAHLYFFHCKLVLDLTQQCRRTLMEQPLTTLN
IHLFIKTMKAPLLTEVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLG
KAGVLLLLRDSLEVNIPQHANVVFKRAEKGVPVEFLVLHDVDLIISHVEHNTHIEEIQED
EDDDMEGPDIDVQDDEVAETVFRDRKRKLPLELTVELTEETFNATVMASDSIVLFYAGWQ
AVSMAFLQSYVDVAVKLKGTSTMLLTRINCADWSDVCTKQNVTEFPIVKMYKKGENPVSY
AGMLGTKDLLKFIQLNRISYPVNITSIQEAEEYLSGELYKDLISYSSVSVLGLFSPTMTT
AKEDFSEAGNDLKGYVITGIYSEEDVLLLSNKYAASLPALLLARHTEGKIESIPLAITRA
EDIVQIVTDALLEMFPEITVENLPSYFRLQKPLLILFSDGSINPQYKKAILTLVKQKYLD
SLTPCWLNLKNTPVGRRILRAYFDPLPPLPVLVLVNLHSGGQVFAFPSDQAIIEENLVLW
LKKLEAGLENHISKFSVLFNTCSSVFCSINVKL
Download sequence
Identical sequences ENSPANP00000016879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]