SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016930 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016930
Domain Number 1 Region: 253-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-34
Family UBX domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 174-269
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.24e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000034
Family TAP-C domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016930   Gene: ENSPANG00000013448   Transcript: ENSPANT00000002252
Sequence length 370
Comment pep:known_by_projection chromosome:PapAnu2.0:10:34253871:34276759:-1 gene:ENSPANG00000013448 transcript:ENSPANT00000002252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERQEALREFVAVTGAEEERARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT
Download sequence
Identical sequences A0A096NV55 A0A2K5NJV2 A0A2K5VJS2 A0A2K6D0W9 I0FG44
NP_001253592.1.72884 XP_005568608.1.63531 XP_011764512.1.29376 XP_011907729.1.92194 ENSPANP00000016930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]