SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016943 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016943
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.27e-93
Family Transglutaminase core 0.000000000729
Further Details:      
 
Domain Number 2 Region: 260-372
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.18e-31
Family Transglutaminase, two C-terminal domains 0.000000952
Further Details:      
 
Domain Number 3 Region: 372-470
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.28e-27
Family Transglutaminase, two C-terminal domains 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016943   Gene: ENSPANG00000021244   Transcript: ENSPANT00000025934
Sequence length 471
Comment pep:known_by_projection chromosome:PapAnu2.0:10:35109541:35137931:1 gene:ENSPANG00000021244 transcript:ENSPANT00000025934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINSNDDNGVLAGNWSGTYTGGRDPRNWNGSVEILKDWKKSGFSPVRYGQCWVFAGTLNT
ALRSLGIPSRVITNFSSAHDTDRNLSVDVYYDRMGNPLDKGSDSVWNFHVWNEGWFVRSD
LGPSYSGWQVLDATPQERSQGVFQCGPASVIGIREGDVNLNFDMPFIFAEVNADRITWLY
DGTTGRQTKNSVDTRTIGRYISTKAVGSNARMDVTDKYKYPEGSDQERRVFQKALGKLKP
NASFGATSSMGLEAEEQESSIIGKFKVTGMLAVGKEVNLVLLLKNLSSDTKTVTVNMTAW
TIVYNGTLVHEVWKDSATMSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDEP
GVVVERDIILDNPTLTLEVLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNL
KIDVPTLRPKERSRVRFEILPTRSGTKQLLADFSCNKFHAIKAMLSIDVVE
Download sequence
Identical sequences ENSPANP00000016943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]