SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016945 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016945
Domain Number 1 Region: 141-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.2e-126
Family Transglutaminase core 0.00000000334
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 3.39e-42
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 492-603
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.49e-25
Family Transglutaminase, two C-terminal domains 0.00039
Further Details:      
 
Domain Number 4 Region: 606-701
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-23
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016945   Gene: ENSPANG00000003905   Transcript: ENSPANT00000013701
Sequence length 704
Comment pep:known_by_projection chromosome:PapAnu2.0:10:35189629:35229426:1 gene:ENSPANG00000003905 transcript:ENSPANT00000013701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRAPDCEETFIFMVETGP
RASEALHTKAVFQTSELELGEGWTAAKEAQVENTLTVSLASPPNAVIGRYLLSIRLSSHR
KHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYGQF
EEDILNICLSILDRSPGHQNNPATDVSCRHDPIYVTRVISAMVNSNNDRGVVQGQWQGKY
DGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSAH
DTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQEE
SEGVFQCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKIGR
CISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVKRLFSMKASGRRTWIRRAGGRCLW
HDDLLEPTTKPSITGKFKLLEPPMLGHDLRLALCLANLTSRVQQVRVNLSGATILYTRKP
VAEILHESHAVRLGRQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEKDI
TLEDFITIKVLGPAMVGVAVTVEVTVVNPLLERVKDCALMVEGSGFLQEQLSIDVPTLEP
QERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVATAK
Download sequence
Identical sequences ENSPANP00000016945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]