SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016983 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000016983
Domain Number - Region: 496-621
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family IMD domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016983   Gene: ENSPANG00000022394   Transcript: ENSPANT00000027481
Sequence length 708
Comment pep:known_by_projection chromosome:PapAnu2.0:7:113621872:113683205:-1 gene:ENSPANG00000022394 transcript:ENSPANT00000027481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERI
QRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGV
NTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSE
VKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGA
YLRNDIFEDAAILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDA
EQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVETGYLKSR
SAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANL
YFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTL
NCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVD
TVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHAL
CNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS
Download sequence
Identical sequences A0A0D9RPV9 A0A2K5MU12 A0A2K5TME7 A0A2K5ZZ31 A0A2K6E3Q1 A0A2K6QEE9 F7BUS9
ENSMMUP00000024027 ENSMMUP00000032891 ENSPANP00000016983 NP_001248177.1.72884 XP_005561403.1.63531 XP_007984984.1.81039 XP_010354536.1.97406 XP_011725765.1.29376 XP_011844984.1.47321 XP_011917310.1.92194 9544.ENSMMUP00000032891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]