SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017033 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017033
Domain Number 1 Region: 677-813,887-1035,1107-1165
Classification Level Classification E-value
Superfamily L domain-like 1.12e-40
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 1200-1367
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 7.59e-32
Family Outer arm dynein light chain 1 0.00033
Further Details:      
 
Domain Number 3 Region: 54-235
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 3.14e-30
Family Outer arm dynein light chain 1 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017033   Gene: ENSPANG00000020908   Transcript: ENSPANT00000021461
Sequence length 1482
Comment pep:known_by_projection chromosome:PapAnu2.0:7:116357302:116486205:1 gene:ENSPANG00000020908 transcript:ENSPANT00000021461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIESENLNQEEIIKELCLCNGLSYEMVGQEGSDTSKLEMFFLGYPRIVGLSLFPNLTSLT
IVAQDIKEIAGLEPCLQLKELWIAECCIEKIEGLQECRNLEKLYLYFNKISKIENLEKLI
KLKVLWLNHNSIKIIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQVCSF
KELTNLTRLPCLKDLCLNDPQYKTNPVCLLCNYSTHVLYHLPCLQRFDTLDVSAKQIKEL
ADTTAMKKIMYYNMRIKTLQRHLNEDLEKLNDRKCKLQKLPEERIKLFSFVKKTLERELA
ELKGSGKGHSDGSNNSKVTDPETLKSCETVTEEPSLQQKILTKLSALNERVTFWNKKLDE
IEAIYHTEVKQKKKSHGLLIPLLLTELETVGNFHFEEGTRSDDWFNFCYELILSRFCAWD
FRTYGITGVKVKRIIKVNNRILRLKFEEKFQKFLENEDMHDSESYRRMLECLFYVFDPEV
TVKKKHLLQILEKGFKESETSKLPLKKEAVILSNSLSISECPRIEFLQQKHKDEKKNSLK
HELFRHGILLITKVFLGQSAQAHEKESISQSNYPMVNSVFIPRKYLLNSVMGQRNCDCSV
RQCKWFVFDHDLVLPEYVVEFEYITMVKSPSLFSVFNNVILEESKKNPEGSVFSKDLKFD
DEVIKMEPRIKARPKLISLDDKTILSLAKTSVYSHIVSLNLHGNSLSKLRDLSKLTGLRK
LNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGDEIN
MLCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHLNGVFISEEEATAAMKFIAGTR
ITQLSLLRHSSTKEERPRILSIWPSAKILTQISKLGPHLHPSGNWYLKITALNLDGQHLF
EITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRLSI
NNNLLTGLEQHTFDNMLHLHSLSLENNRITSLSGLQKSFTLVELYISNNYIAVNQEMYNL
KGLCNLVILDMCGNIIIWNQENYRLFVIFHLPELKALDGISIEPPETENAKDLFGGRLTS
DMIAERQGHSNFMQMQELNWTSSSIRTVDLIPVDQFRNVCNVNLQNNNLTSFSGLIYLPN
VKVLCLNYNHIESIMPRLKPQTHLTNRQLLYQKVPSSGYGQQGISKTNRDIMSSENLPPI
MHSLEVLHLGYNGICNLIQLQLNRLRNLKFLFLQGNEISQVEGLDNLVVLQELVVDHNRI
RSFNDSAFAKPSSLLALHLEENRLRELGKLQSLVKLEKLFLGYNKIQDITELEKLDVIST
LRELTVYGNPICRKMLHRHMLIFRLPNLQMLDGSPVNSDDRAKAEFHLAELQAKKNSLIP
VTHCPMDGRSFGQVKTPPIKVTNVILPSGFSHCLGSDVTLTPEVEDKKNKNAGILTNNPR
SIHAEIAFQQLRGIGISPSVLSHQNIASPTAQIYQSNQDERR
Download sequence
Identical sequences ENSPANP00000017033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]