SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017034 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017034
Domain Number 1 Region: 103-360
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-50
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 421-617,654-758
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.81e-33
Family Extended AAA-ATPase domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017034   Gene: ENSPANG00000022389   Transcript: ENSPANT00000028780
Sequence length 843
Comment pep:known_by_projection chromosome:PapAnu2.0:10:38727808:38770574:1 gene:ENSPANG00000022389 transcript:ENSPANT00000028780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNREYRGRGFGRGRFQSWKRGRGGRNFSGKWRERGHRPDLSQTTGKHTSEQTPQSLLSTK
TPQSMQSTLDQLIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIYLYDKDEIERKGS
ILVDFKELIKDDEVTNLIPDTANELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEG
LSSDGETMVNVPHVHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAF
LCAACGEVQSFPLPDGKYSLPTKCPVPACRGRSFTALRSSPLTVTMDWQSIKIQELMSDD
QREAGRIPRTIECELVHDLVDSCVPGDTVTVTGIVKVSNAEEGSRNKNDKCMFLLYIEAN
SISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHEAL
ELVKAGLALALFGGSQKFADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYV
CGNTTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQ
SISLAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTP
NEHHDHLLSEHVIAIRAGKQRTISSVTVARTNSQDSNTSVLEVVSEKPLSERLKVVPGET
IDPIPHQLLRKYIGYARQYVYPRLSKEAAQVLQDFYLELRKQSQRLNSSPITTRQLESLI
RLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAK
RFISALNNIAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQL
QTM
Download sequence
Identical sequences ENSPANP00000017034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]