SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017044 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017044
Domain Number 1 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 285-331,503-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000768
Family Second domain of FERM 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017044
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000973
Family Ubiquitin-related 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017044   Gene: ENSPANG00000020969   Transcript: ENSPANT00000016853
Sequence length 573
Comment pep:known_by_projection chromosome:PapAnu2.0:10:38852801:38896136:-1 gene:ENSPANG00000020969 transcript:ENSPANT00000016853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTDFTSASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDVLNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPVSSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLLKAFKQYWFVFKDTSIAYFKNKELEQGEPVEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVR
Download sequence
Identical sequences A0A096NVG9
ENSPANP00000017044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]