SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017050
Domain Number 1 Region: 305-368,409-580
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 9.15e-71
Family C-terminal domain of PLC-beta 0.0000277
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.15e-34
Family Mammalian PLC 0.0000561
Further Details:      
 
Domain Number 3 Region: 86-204
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-25
Family PLC-like (P variant) 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017050   Gene: ENSPANG00000004887   Transcript: ENSPANT00000016859
Sequence length 625
Comment pep:known_by_projection chromosome:PapAnu2.0:10:41514783:41670115:1 gene:ENSPANG00000004887 transcript:ENSPANT00000016859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLK
PEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRK
AFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGY
HYICLRNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALT
LEDEEEVKKEADPGETPSETPSEVRTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAP
AKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTK
YNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDK
QQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKK
MDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEI
RQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPG
KVNHKTPSSEELGGDIPGKEFDTPL
Download sequence
Identical sequences ENSPANP00000017050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]