SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017068 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017068
Domain Number 1 Region: 347-476
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.3e-22
Family Synaptotagmin-like (S variant) 0.0073
Further Details:      
 
Domain Number 2 Region: 502-583
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000405
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017068   Gene: ENSPANG00000018435   Transcript: ENSPANT00000026619
Sequence length 585
Comment pep:known_by_projection chromosome:PapAnu2.0:7:118391478:118534416:1 gene:ENSPANG00000018435 transcript:ENSPANT00000026619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAMASQDAQNFFQPFSSWISRVYEALQQAGDMLSASLVNVSKQDSKLSDKLDQDLDNI
QIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQDSAQNSSPRLSQHAKDSCSTM
SQWPNRASDDHKSPHVLSSIAEEEHHLEKQRSGLQHGFDSQLPGTLETINGKKQVNSFGD
DEELSTSSDSDEEVIKQFEISVSRSQSFRSVTSEKGKQTGLEQKPKFSRLLLTHGEDGTE
VSACEDLDGASQRRYSENLSYGEDDHISAHSQSPCERGDAKHHGTSHQESNVVQSLRRQS
TEGSLEMETAFNSRGFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISKCGDLDVIFEY
RASSQKLTVTIVRAQGLPDKDRSGVNSWQVHVVLLPGKKQRGRTNIQRGPNPVFKEKVTF
TKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSG
GSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRA
PDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQQTDKK
Download sequence
Identical sequences ENSPANP00000017068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]