SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017089 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017089
Domain Number 1 Region: 2-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-116
Family Motor proteins 0.00000000664
Further Details:      
 
Domain Number 2 Region: 440-544
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.29e-23
Family FHA domain 0.00035
Further Details:      
 
Domain Number 3 Region: 1163-1226
Classification Level Classification E-value
Superfamily PX domain 0.000000000719
Family PX domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017089   Gene: ENSPANG00000019915   Transcript: ENSPANT00000013650
Sequence length 1227
Comment pep:known_by_projection chromosome:PapAnu2.0:10:49075231:49383323:-1 gene:ENSPANG00000019915 transcript:ENSPANT00000013650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDFSFYSADTKSPDY
VSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSGLIPRICEGLFSR
INETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKEGPYVEADLSKHL
VQNYADVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEMPCETVSKIHLV
DLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALVADLSQDATNTLAKKKPVFVPY
RDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDANV
KLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTKEWTNKWNETQ
NILKEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYVGREDASTEQD
IVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIMEATHLNQGAVILLGRTNMFR
FNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFERQQREELEKLE
SKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKRRSFHIENKLK
DLLAEKEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEKAEKFQIFQEL
DRLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEEQLREKQEMIQLLRRGEVQWVEEE
KRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLEKDLVQQKDLL
KKEVQEEQEILECLKCEHDKESRLLGKHEESVTDVTEVAHDFEKIKPVEYRLQYKERQLQ
YLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQANASQLQKLQ
ATFEFTANIARQEEKVRKKEKEILESREKQQREALERALARLERRHSALQRRSTLGMEIE
EQRQKLASLNSGSREQSGLQASLEAEREALEKDQERLEYEIQQLKQKIYEADGVQKSHHG
TLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEEVQRRLQDLHRVISEGCSTSADMMKD
NEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPRYVLCGQGKDAHFEFEVKITV
LDETWTVFRRYSRFREMHKTLKLKYAE
Download sequence
Identical sequences ENSPANP00000017089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]