SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017116 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017116
Domain Number 1 Region: 126-232
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.14e-28
Family DEP domain 0.00000313
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-25
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 243-351
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-25
Family Pleckstrin-homology domain (PH domain) 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017116   Gene: ENSPANG00000023846   Transcript: ENSPANT00000011692
Sequence length 353
Comment pep:known_by_projection chromosome:PapAnu2.0:7:123502078:123531783:-1 gene:ENSPANG00000023846 transcript:ENSPANT00000011692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRIFLDGCTITC
PCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNS
FKLPPHISLHRIVDKMHDSSTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFVASRLEA
VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEINLS
TVELSGMVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT
Download sequence
Identical sequences A0A096NVP1 A0A0D9RLJ2 A0A2K5MWT3 A0A2K5X751 A0A2K5XY84 A0A2K6C8G3 F7EFD3
9544.ENSMMUP00000028219 ENSMMUP00000028219 ENSPANP00000017116 ENSMMUP00000028219 XP_001106525.1.72884 XP_005561613.1.63531 XP_007985250.1.81039 XP_011724705.1.29376 XP_011849623.1.47321 XP_011909249.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]