SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017117 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017117
Domain Number 1 Region: 469-533,575-673
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-32
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 679-806
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-19
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 1093-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-19
Family Second domain of FERM 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017117
Domain Number - Region: 994-1071
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00124
Family Ubiquitin-related 0.055
Further Details:      
 
Domain Number - Region: 40-128,580-600
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00126
Family BAR domain 0.05
Further Details:      
 
Domain Number - Region: 1229-1287
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Third domain of FERM 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017117   Gene: ENSPANG00000013443   Transcript: ENSPANT00000019409
Sequence length 1364
Comment pep:known_by_projection chromosome:PapAnu2.0:7:123661604:123714636:1 gene:ENSPANG00000013443 transcript:ENSPANT00000019409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVDARASVDWQKRCLTLETQLFRFRLQASRIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSGGSLHQKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAELEMENQHLKSHNQHLVEQVGALQDALEAIQIAPSRKLLV
PSHGAAEQDSVPSEPGIQPTGQNSGSQAEGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSMVHSGEMVEAKPLQPHLGRAGPPHQPCMKLRTFRCGSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRTPGTPRDSIQLTKRHHSQPQVGHGHFDRVVSIEIGAFSALHPSG
LPELEFRARYWEEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDVSPRSNTACCASSPPALASPGSFSGLVYKNVTVPVYTALKGRA
TQISNMPFMDESSGSDDDCSSQASFRISVPCSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSRVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLL
EEWIRVLQSLLKVQATGPPALPRGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSH
EDKRPLGCLPVQDARIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPAEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQ
LMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYC
QRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYQVVGFDGSSTVD
EFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPRK
SEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPVNKELALEMAALM
AQVEYGDLEKPALPGPGATSPAKAQHLLQQVLDRFYPRRYRHGAPPEQLRHLADMLTTKW
ATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN
TMQVHVTYPYSSVTTFGGCRDDFMLVIRSIPDKTSGKSHIEKLIFRMAAPKIAEATFIMA
SYMNHCSTTVNPPTNLPGACQLWELDGQQFFSSVSCATKGPTLL
Download sequence
Identical sequences A0A096NVP2
ENSPANP00000017117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]