SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017125 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017125
Domain Number 1 Region: 71-513
Classification Level Classification E-value
Superfamily TPR-like 5.22e-82
Family HAT/Suf repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 516-611
Classification Level Classification E-value
Superfamily TPR-like 1.61e-18
Family HAT/Suf repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017125   Gene: ENSPANG00000017420   Transcript: ENSPANT00000018514
Sequence length 687
Comment pep:known_by_projection chromosome:PapAnu2.0:10:52766465:52782904:-1 gene:ENSPANG00000017420 transcript:ENSPANT00000018514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTAAGKQRIPKVAKVKNKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELN
DYKLRKRKTFEDNIRKNRTVISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLK
YAEMEMKNRQVNHARNIWDRAITTLPRVNQFWYKYTYMEEMLGNIAGARQVFERWMEWQP
EEQAWHSYINFELRYKEVDRARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYER
AVEFFGDEHMDEHLYVAFAKFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKK
FGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANV
PPIQEKRHWKRYIYLWINYALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQ
FEIRQKNLSLARRALGTSIGKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCT
SWIKFAELETILGDIDRARAIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRR
LLQRTQHVKVWISFAQFELSSGKEGSLAKCRQIYEEANKTMRNCEEKEERLMLLESWRSF
EEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAM
AKLWKKQQQEKEDAEHHPDEDVDESES
Download sequence
Identical sequences A0A096NVQ0 A0A0D9RG97 A0A2K5M747 A0A2K5WYF0 A0A2K5Z0N5 A0A2K6CWZ4 F6T9A8
ENSMMUP00000010128 9544.ENSMMUP00000037420 ENSPANP00000017125 XP_007959622.1.81039 XP_011748163.1.29376 XP_011907342.1.92194 XP_015005063.1.72884 XP_015313232.1.63531 ENSMMUP00000037420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]