SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017127 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017127
Domain Number 1 Region: 12-98
Classification Level Classification E-value
Superfamily t-snare proteins 6.36e-21
Family t-snare proteins 0.0023
Further Details:      
 
Domain Number 2 Region: 139-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000144
Family SNARE fusion complex 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017127   Gene: ENSPANG00000023579   Transcript: ENSPANT00000022384
Sequence length 232
Comment pep:known_by_projection chromosome:PapAnu2.0:7:123780085:123803603:-1 gene:ENSPANG00000023579 transcript:ENSPANT00000022384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLA
EMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYALENE
HMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSR
LVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELAILGGLVYYKFFRSH
Download sequence
Identical sequences A0A096NVQ2 A0A2K5NMN4 A0A2K5YKF8 A0A2K6AUZ4 F7C233 I7GDL8
ENSMMUP00000020864 9544.ENSMMUP00000020864 ENSMMUP00000020864 NP_001253288.1.72884 NP_001271552.1.63531 XP_011724722.1.29376 XP_011849614.1.47321 XP_011909268.1.92194 ENSPANP00000017127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]