SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017128 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017128
Domain Number 1 Region: 665-780,945-998
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000032
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017128
Domain Number - Region: 463-569
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000924
Family N-acetyl transferase, NAT 0.021
Further Details:      
 
Domain Number - Region: 179-247
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00109
Family N-myristoyl transferase, NMT 0.065
Further Details:      
 
Domain Number - Region: 737-802,833-905
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0473
Family FAD/NAD-linked reductases, N-terminal and central domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017128   Gene: ENSPANG00000024586   Transcript: ENSPANT00000012213
Sequence length 1237
Comment pep:known_by_projection chromosome:PapAnu2.0:10:52786984:53079941:1 gene:ENSPANG00000024586 transcript:ENSPANT00000012213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTESQDIYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVAKQDNWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHY
PQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVAGTAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLEAPQELSVRRSQDAELRSSSQGSQKI
VEESQEPVFPDTMENIQGNIAKEAASEEALTAVQSGSVSEPEDIEKLSDVSTGYAQDHRV
SSRSLASLFLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFC
IISLPHLTPEFILIQNFVKMVPFSTCTLEQDLYVFHRAGLLKSIHIRFATFLDTPGVENL
VSTLMLNKSILEDLDRYNKARKDPDGTLLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYN
IEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYPVYPKSREGKF
QNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEP
KITVNAKIIVVGASNVGISFLETLVFCSHLKFNNLTLISTHGLPGKKLLDTEQRKFLASD
HCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTGEIVLYDHLILCTGQQYQVPCP
TGADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALTWIRSNSITTEGNVIVY
GNTIDTYTTVETLLNLGVSGSRVHLVQPPPASTITCINNYSVESAVADALAAAGVTIYRD
AILAQWNDGLHPDPIYSASFTTPTKPFRLPCSMFFSFCEKNVDYETFKALNDTCLVYDGR
LVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEP
VTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLEIVTGN
AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLY
SYFTEPWCLALFHDRFIDLRKELRQILASKEEEDLPSIEQLAHQIEDEEINPTEKPRQYL
KRVFEESIYKTLVERSTLDYLHYNRYHLPMYAWPGII
Download sequence
Identical sequences A0A096NVQ3
ENSPANP00000017128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]