SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017143 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017143
Domain Number 1 Region: 87-258
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-47
Family DnaQ-like 3'-5' exonuclease 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017143   Gene: ENSPANG00000025013   Transcript: ENSPANT00000023133
Sequence length 620
Comment pep:known_by_projection chromosome:PapAnu2.0:7:125344952:125377213:1 gene:ENSPANG00000025013 transcript:ENSPANT00000023133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQNFVALTVTTLLGVAIGGFVLWKGIQRRRRSKTSPVTPQPQQKVLGSRELPPPEDDQ
LHSSAPRSSWEEQILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWVNLEGKASP
LSLLQMASPSGLCVLIRLPKLICGGKTLPRTLLNILADGTILKVGVGCSEDASKLLQDYG
LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQV
IYAARDAQISVALFLHLLGYPFSRNSPGEKNDHSSWRKVLEKCQGVVDIPFRSKGMSRLG
EEVNGEATESQQKPKHKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPLYDNCFLH
APDGQPLCTCDRRKAQWYLDKGIGELVSEEPFVVKLRFEPAGRPESPGDYYLMVKENLCV
VCGKRDSYIRKNVIPHEYRKHFPIEMKDHNSHDVLLLCTSCHAISNYYDNHLKQQLAKEF
QAPIGSEEGLRLLEDPERRQVRSGARALLNAESLPAHRKEELLQALREFYNTDTVTEEML
QEAASLETRISNENYVPHGLKVVQYHSQGGLRSLMQLESRWRQHFLDSMQPKHLPQQWSV
DHNHQKLLRKFGEDLPIQLS
Download sequence
Identical sequences A0A096NVR8 A0A2K6AJI6
ENSPANP00000017143 XP_011856275.1.47321 XP_011856276.1.47321 XP_011856277.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]