SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017184 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017184
Domain Number 1 Region: 55-218
Classification Level Classification E-value
Superfamily TPR-like 1.55e-23
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017184   Gene: ENSPANG00000017558   Transcript: ENSPANT00000025078
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:7:126719662:126750946:1 gene:ENSPANG00000017558 transcript:ENSPANT00000025078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKGSASGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEF
KSQGAQCYKDKKFREAIGKYHRALLELKGLLPPPGEREQDSRAASPAGAPKPGRLSEEQS
KTVEAIEIDCYNSLAACLLQAELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDY
DKALYYLKEARTQQPTDTNVIRYIQLTEMKLSRCSQREKEAM
Download sequence
Identical sequences A0A096NVV9 A0A0D9RKK5 A0A2K5N1P3 A0A2K5WHQ0 A0A2K6BQ81
XP_005562525.2.63531 XP_011760948.1.29376 XP_014999516.1.72884 ENSPANP00000017184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]