SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017185 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017185
Domain Number 1 Region: 118-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-78
Family Protein kinases, catalytic subunit 0.0000144
Further Details:      
 
Domain Number 2 Region: 51-131
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-20
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017185
Domain Number - Region: 420-488
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00259
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017185   Gene: ENSPANG00000024112   Transcript: ENSPANT00000027719
Sequence length 1102
Comment pep:known_by_projection chromosome:PapAnu2.0:7:126807768:126889309:-1 gene:ENSPANG00000024112 transcript:ENSPANT00000027719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAGPGELGCDAPLPYWTAVFE
YEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQ
PGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDIS
QTIENVRQEAKLFTMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDIL
VNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWH
RTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVA
MNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFHCL
QDDWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILER
ELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSL
INSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPG
TLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRS
SPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPT
PVNSATSTPQLTPTNSLKRGSAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLLPLEE
PEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPAASLTLLSLSSISE
CNSTRSLLRSDSDEIVVYEMPVSPVEAPPLTPCTHNPLVNVRVERFKRDPNQSLTPTHVT
LTAPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLP
DPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSPAN
SSSTETPSNLDSCFASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDSTVP
LCRAELNTHRPAPYEIQQEFWS
Download sequence
Identical sequences A0A096NVW0
ENSPANP00000017185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]