SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017187 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017187
Domain Number 1 Region: 9-75,195-262
Classification Level Classification E-value
Superfamily EF-hand 1.34e-18
Family Calbindin D9K 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017187   Gene: ENSPANG00000016039   Transcript: ENSPANT00000019774
Sequence length 1381
Comment pep:known_by_projection chromosome:PapAnu2.0:10:58048182:58115675:-1 gene:ENSPANG00000016039 transcript:ENSPANT00000019774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEENHYVSQLREVYSSCDTTGTGFLDRQELTQLCLKLHLEQQLPVLLQTLLGNDHFAR
VNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKYVNGSKWYGRRSRPELCDT
ATEARHVPEQQTQASLKSQLWRSASLESVESLKSDEEAESTKEAQNELFEAQGQLQTWDT
EDFGSPEKCCSPSFDTPESQIRGMWEELGVGSHGHLSEQELAVVCQSVGLRELEKEELED
LFNKLDQDRDGKVSLEEFQLGLFSHEPALLLESSTQVKVSKPWSHYQVPEESGCHTTTTS
SLMSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSVDEKVNLLELT
WALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLVRERDKARQDLERAEKRNLEFVKE
MDDCHSALEQLTEKKIKHLEQGYRERLSLLRSEVEAERELFWEQAHRQRAALEWDVGRLQ
AEEAGLREKLTLALKKHPRVSFLLLQMIMQSSRIYRLLIKPHVLLCFVAYDLKQMVSSLV
VKAAEPFAKVPPIYPVIESDDLQDRNDELQAELEGLWARLPKNQHSPSWSPGGCRRQLSG
LGPAGISFLGNSVPVSIETELMMEQVKEHYQDLRTQLETKVNHYEREIAALKRNFEKERK
DMEQARRREVSVLEGQKADLEELHKKSQEVIWGLQEQLQDTAHDPEPERMGLAPCCTQAL
CGLALRHQSHLRQIRREAHAELSGELLGLRALPARRDLTLELEEPLQGPLPRGSRRSEQL
NLESALNLECASEKGAQMCASLALEEELELAGGKRVDGLSREAEMLGALPKEGLVAGSGR
EGARGLLPLSPGYGERPLAWLTPGDGGESEEAAGAGSRCRQAQDTEATTASHGPSERWSH
VQPCGVDGGTVPEEPELFGVPVGLKQPGPRELPLLGTEGDASQTQPRMWESPLSPAASCR
GQAEKPQAIQEERARSWSRGTQGQASEEQARAEGALESACQEHGVEVARRGSLPSHFQLS
DPRASRQEQLAAPEEGETKTALEREKDDMETKLLHLEDVVRALEKHVDLRENDRLEFHRL
SEENALLKNDLGRVRQELEAAESTHNAQRKEIEVLKKDKEKACSEMEVLTRQNQNYKDQL
SQLNDRVLQLGQEASTHQSQSEEHRVTIQLLTQSLEEVACSGQQQSDQIQKLKVELECLN
QEYQSLQLSQSELTQALEESQGQVQGAHLRLRQAQAQHSQEVRQLQEQMSRLVPQDRVAE
LQRLLSLQGEQAGRRLDAQREEHEKQLKATEERVEEAEMILKNMEMLLQEKVNELKEQFE
KNTKSDLLLKELYVENAHLVRALQATEEKQRGAQKQSRILEEKVRALNKLVSRIAPAALS
V
Download sequence
Identical sequences ENSPANP00000017187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]