SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017193 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017193
Domain Number 1 Region: 308-435
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-41
Family Regulator of G-protein signaling, RGS 0.0000265
Further Details:      
 
Domain Number 2 Region: 10-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-27
Family DEP domain 0.015
Further Details:      
 
Domain Number 3 Region: 234-297
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.19e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017193   Gene: ENSPANG00000006945   Transcript: ENSPANT00000025829
Sequence length 474
Comment pep:known_by_projection chromosome:PapAnu2.0:7:128427016:128620944:1 gene:ENSPANG00000006945 transcript:ENSPANT00000025829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENNTFFNLFQIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDVVQWLMKNLSIE
DPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLC
KRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQE
RAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKT
TKEDIRKQITFLNTQIDRHCLKMSKVAESLIAYTEQYMEYDPLITPAEPSNPWISDDVAL
WDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQP
LQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSD
SYARFLRSNAYQDLLLAKKKPESEQGRRTSLEKFTRSVGKSLAGKRLTGLMQSS
Download sequence
Identical sequences ENSPANP00000017193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]