SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017195 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017195
Domain Number 1 Region: 304-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-17
Family PHD domain 0.0046
Further Details:      
 
Domain Number 2 Region: 256-317
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000354
Family PHD domain 0.034
Further Details:      
 
Domain Number 3 Region: 193-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000013
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017195   Gene: ENSPANG00000018213   Transcript: ENSPANT00000027168
Sequence length 378
Comment pep:known_by_projection chromosome:PapAnu2.0:7:128675599:128949249:-1 gene:ENSPANG00000018213 transcript:ENSPANT00000027168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKR
HRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEA
LLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSA
GGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPN
HRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTL
NMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSC
HLCWELLKEKASAFGCQA
Download sequence
Identical sequences A0A096NVX0 A0A2I2U7K3 A0A2I3TTJ2 A0A2K5CUG1 A0A2K5KNR4 A0A2K5ZCI9 A0A2K6BNL9 A0A2K6QRG7 F6SJG9 F7IKV4 G1QPT3 G3S544 I3NBS0 Q92784
ENSECAP00000022258 ENSECAP00000022258 ENSCJAP00000026739 ENSCJAP00000026737 ENSP00000450518 NP_001267471.1.87134 NP_001267471.1.92137 XP_002754118.1.60252 XP_003263707.1.23891 XP_003824173.1.60992 XP_005321254.1.77405 XP_005605350.1.31192 XP_007095168.1.5354 XP_007985371.1.81039 XP_008521989.1.77740 XP_008521991.1.77740 XP_008762971.1.100692 XP_010354080.1.97406 XP_011281622.1.62641 XP_011760914.1.29376 XP_011838508.1.47321 XP_011945237.1.92194 XP_011945238.1.92194 XP_012293472.1.9421 XP_014639853.1.5094 XP_014691239.1.49734 XP_014927177.1.86478 XP_014999518.1.72884 XP_016781803.1.37143 XP_016877159.1.92137 XP_017738271.1.44346 XP_018865570.1.27298 XP_021509402.1.76796 ENSGGOP00000023198 ENSP00000450518 ENSPANP00000017195 9796.ENSECAP00000022258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]