SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017202 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017202
Domain Number 1 Region: 561-673
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 702-775
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.35e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 153-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.25e-18
Family G proteins 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017202
Domain Number - Region: 24-117,422-471,605-627
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00235
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017202   Gene: ENSPANG00000009729   Transcript: ENSPANT00000025828
Sequence length 791
Comment pep:known_by_projection chromosome:PapAnu2.0:7:129025695:129086006:-1 gene:ENSPANG00000009729 transcript:ENSPANT00000025828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHER
IRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YNVSNLQGSLEAEEMDEETKRKKMTEKVVSFLLVDENEEVQQVTNEEDFIRKLDCKPDQH
LKVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGL
LGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATT
ARCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHY
KGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHS
SFFPDEYFTCSSLCLSCGVGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERG
EEVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEI
VHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNS
QILSCNKCATSFKDNDTKHHCRACGEGFCDGCSSKTRPVPERGWGPAPVRVCDNCYEARN
VQLAITEAQVDDEGGTLIARKVGEAVQSTLGAVVTAIDIPLGLVKDAARPAYWVPDHEIL
HCHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGAWTS
LSVVTGKSPLC
Download sequence
Identical sequences ENSPANP00000017202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]