SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017233 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017233
Domain Number 1 Region: 207-530
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.09e-80
Family Tex N-terminal region-like 0.0000855
Further Details:      
 
Domain Number 2 Region: 532-677
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-28
Family Tex RuvX-like domain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 908-991
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000701
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 4 Region: 821-898
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000623
Family Tex HhH-containing domain-like 0.013
Further Details:      
 
Domain Number 5 Region: 683-767
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000711
Family Tex HhH-containing domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017233   Gene: ENSPANG00000008063   Transcript: ENSPANT00000000145
Sequence length 995
Comment pep:known_by_projection chromosome:PapAnu2.0:13:44382635:44602926:-1 gene:ENSPANG00000008063 transcript:ENSPANT00000000145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPRRAKVQVQGVLPKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRSHKQPPPKESK
PKRMPRVKKNTPQISDDSEVVVKEELNSSVAIADTALEDRKNKLDTVQTLKTAKTKRKCS
AQPHAAQRTKKLKVDEETSKASNLEGESNSSETPSTSTMWGGTCKKEENEDDFTFGQSPL
KKMKTETCPQGQLVKFPANANNIKEEVEMNWDIVQVLSERTNIEPWVCANTIRLFNDDNT
IPFIIRYRKELINNLDADSLREVQQTLEELRAVAKKVHSTIQKIKKEGKMSECLLKAMLN
CKTFEELEHVSAPYKTGSKGTKAQRARQLGLEGAARALLEKPGELSLLSYIRPDVKGLST
LQDIEIGVQHILADMIAKDKDTLDFIRNLCQNRHVCIQSSLAKVSSKKVNEKDVDKFLLY
QHFSCNIRSIHHHQILAINRGENLKVLTVKVNISDGVKDEFCRWCIQNRWRPRGFARPEL
MKILRDSLNDSFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLMG
VDPGYKHGCKLAIISPTSQILHTDVVYLHCGQGFREAEKIKRLLLNFNCSTVVIGNGTAC
RETEAYFADLIMKNYFAPLDVVYCIVSEAGASIYSVSPEANKEMPGLDPNLRSAACFARS
YMSLLYHLMMIENEMVGQNIYTHHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLSP
NSARGREHVYKVVKYRTSMGLYIALTALKKIEVMSPQCYYICLFKICLNASYTDVLHSQQ
TESSGQIRGVAVTSSADIEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFL
SSIGGTLYEIGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTD
FDKPDFKRSIVCLEDLQVGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTK
KRRSLGLGPGERVEVQVLNIDVPRSRITLDLIRVL
Download sequence
Identical sequences ENSPANP00000017233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]