SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017243 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017243
Domain Number 1 Region: 308-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 208-298
Classification Level Classification E-value
Superfamily PKD domain 0.0000000183
Family PKD domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017243   Gene: ENSPANG00000019276   Transcript: ENSPANT00000022188
Sequence length 501
Comment pep:known_by_projection chromosome:PapAnu2.0:4:112753927:112797659:1 gene:ENSPANG00000019276 transcript:ENSPANT00000022188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTARESAGSRRRRPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLE
EFRRQLQQERPQEELELELRSGGGPQEDCPGPGGGGYSAMPDAIIRTKDSLAAGASFLRA
PAAVRGWRQCVAACCSEPSCSVAVVELPRRPSPPAAVLGCYLFNCTARGRNVCKFALHRG
YSSYSLSRAPDGAALATARASPRLEKDAPPLSKAGQDVVLHLPTDGVVLDGRESTDDHAI
VQYEWALLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTVMDTAGQRSSDNVSVTVLRAA
YSTGGCLHTCSRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLDRKMVTHVVAS
PALPRTTGPSEDAGVDSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPADS
SSSRKDRKEENYIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQK
LKKARPITSEESDYLINGMYL
Download sequence
Identical sequences ENSPANP00000017243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]